SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG13971_complete:A_SariMG_comp30042_c0_seq4
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000118 C histone deacetylase complex
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000785 C chromatin
GO:0000790 C chromatin
GO:0000792 C heterochromatin
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003729 F mRNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006346 P DNA methylation-dependent heterochromatin assembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008327 F methyl-CpG binding
GO:0019904 F protein domain specific binding
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0031492 F nucleosomal DNA binding
GO:0035197 F siRNA binding
GO:0042127 P regulation of cell population proliferation
GO:0042711 P maternal behavior
GO:0043044 P chromatin remodeling
GO:0043234 C protein-containing complex
GO:0043623 P protein-containing complex assembly
GO:0070742 F C2H2 zinc finger domain binding
RNA-seq EntryA_SariMG_comp30042_c0_seq4
Sequence
(Amino Acid)
MMNISIEKKRSDCPALPKGWQKEEVIRKTGLSAGKVDVYYYRGVRSDVSLVPPIRQTASI
FKQPVTVYKTQESKVKTDLKQGIQEKPKQLFWEKRLEGLTACDANGVIGTTTLPKYIKSL
GPFTSDATTIQSLATALHVSSQPITGQTGSKQAILENPGVFLNPEQPLIAAVTITKDDVR
RQEERVMRARQRLHEALAVA
*(66 a.a.)

- SilkBase 1999-2023 -