SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG13959_complete:A_SariMG_comp30037_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001822 P kidney development
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007283 P spermatogenesis
GO:0007498 P mesoderm development
GO:0008544 P epidermis development
GO:0043588 P skin development
GO:0046872 F metal ion binding
GO:0051729 P germline cell cycle switching, mitotic to meiotic cell cycle
GO:1901994 P negative regulation of meiotic cell cycle phase transition
GO:2000647 P negative regulation of stem cell proliferation
RNA-seq EntryA_SariMG_comp30037_c0_seq3
Sequence
(Amino Acid)
MSFNAKHQLQNHERMHTGERPYTCQVCNVAFSYKVNLNNHVFKVHGINLKFKSVHTFTEE
VLQRELGMASESRAAVAHIMPQLSGDVPPPGAHETVHHTTEY
*(33 a.a.)

- SilkBase 1999-2023 -