SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG13662_complete:A_SariMG_comp29980_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0002021 P response to dietary excess
GO:0003824 F catalytic activity
GO:0004222 F metalloendopeptidase activity
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005777 C peroxisome
GO:0005886 C plasma membrane
GO:0006508 P proteolysis
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0008270 F zinc ion binding
GO:0008340 P determination of adult lifespan
GO:0014067 P negative regulation of phosphatidylinositol 3-kinase signaling
GO:0016485 P protein processing
GO:0016787 F hydrolase activity
GO:0043171 P peptide catabolic process
GO:0045089 P positive regulation of innate immune response
GO:0045926 P negative regulation of growth
GO:0046662 P regulation of oviposition
GO:0046872 F metal ion binding
GO:0048638 P regulation of developmental growth
GO:0050829 P defense response to Gram-negative bacterium
GO:0051603 P proteolysis involved in cellular protein catabolic process
GO:0090062 P regulation of trehalose metabolic process
GO:1901143 P insulin catabolic process
RNA-seq EntryA_SariMG_comp29980_c0_seq1
Sequence
(Amino Acid)
MSGVRRSNGVQGLRVLVQNDRHHPAYVEERIEAFIDGFLEYLEAMTEEEFLKHRSALAAQ
RLEKPKRMSKKATEMWGEITTQMYNFDRARVEVDQLNTITKDELIEYYKKHVSASSSERR
KLSVHVISTAQGGAGSERDNDTSEPQEGKDNQPIKITDLVEFKSRRRLHPLPEPYVNIPR
KGAHCKL
*(61 a.a.)

- SilkBase 1999-2023 -