SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG13604_complete:A_SariMG_comp29967_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0004103 F choline kinase activity
GO:0004104 F cholinesterase activity
GO:0004305 F ethanolamine kinase activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0006580 P ethanolamine metabolic process
GO:0006629 P lipid metabolic process
GO:0006646 P phosphatidylethanolamine biosynthetic process
GO:0006656 P phosphatidylcholine biosynthetic process
GO:0006657 P CDP-choline pathway
GO:0008144 F obsolete drug binding
GO:0008654 P phospholipid biosynthetic process
GO:0009636 P response to toxic substance
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019695 P choline metabolic process
GO:0033265 F choline binding
GO:0042803 F protein homodimerization activity
GO:1904681 P response to 3-methylcholanthrene
RNA-seq EntryA_SariMG_comp29967_c0_seq1
Sequence
(Amino Acid)
MAKEIFIKQYLKHYQANISEIKEYHEPSIDDVNDLLSEVEAFALVSHFFWCLWSIVNASK
SKIPFGYWEYALSRLEMYLRLKQKMIKKDKFGIPQKRKICEVDI
*(34 a.a.)

- SilkBase 1999-2023 -