SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG13373_internal:A_SariMG_comp29923_c0_seq4
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0003360 P brainstem development
GO:0004872 F signaling receptor activity
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007155 P cell adhesion
GO:0007158 P neuron cell-cell adhesion
GO:0007612 P learning
GO:0009986 C cell surface
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0021549 P cerebellum development
GO:0030054 C cell junction
GO:0030182 P neuron differentiation
GO:0030425 C dendrite
GO:0030534 P adult behavior
GO:0031404 F chloride ion binding
GO:0035176 P social behavior
GO:0035265 P organ growth
GO:0042043 F neurexin family protein binding
GO:0042803 F protein homodimerization activity
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0045216 P cell-cell junction organization
GO:0050808 P synapse organization
GO:0050839 F cell adhesion molecule binding
GO:0052689 F carboxylic ester hydrolase activity
GO:0060076 C excitatory synapse
GO:0071625 P vocalization behavior
GO:0090394 P negative regulation of excitatory postsynaptic potential
GO:0097105 P presynaptic membrane assembly
GO:0097110 F scaffold protein binding
RNA-seq EntryA_SariMG_comp29923_c0_seq4
Sequence
(Amino Acid)
IGYFGGNPDDVTISGCSAGSGSVDLLTVSQTTKGLFNKAISDSGGKLGAFALQQNPIQNA
VDRAIKLNFSNVDDITALEESYRAASIELLISTPYSGNTDSSIPFSPCLERDIGQEMFLT
ESPYTILRRGSHERYPRLYGFTNMEGIM
(48 a.a.)

- SilkBase 1999-2023 -