SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG13277_complete:A_SariMG_comp29909_c2_seq7
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000413 P protein peptidyl-prolyl isomerization
GO:0001932 P regulation of protein phosphorylation
GO:0003755 F peptidyl-prolyl cis-trans isomerase activity
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006457 P protein folding
GO:0006952 P defense response
GO:0007165 P signal transduction
GO:0009416 P response to light stimulus
GO:0009585 P red, far-red light phototransduction
GO:0009626 P plant-type hypersensitive response
GO:0009704 P de-etiolation
GO:0009735 P response to cytokinin
GO:0009742 P brassinosteroid mediated signaling pathway
GO:0009785 P blue light signaling pathway
GO:0016853 F isomerase activity
GO:0042277 F peptide binding
GO:0046686 P response to cadmium ion
GO:0048046 C apoplast
RNA-seq EntryA_SariMG_comp29909_c2_seq7
Sequence
(Amino Acid)
MNVNSGGQRNPLVYLDISIDAEQAGRIVIELRSDVVPKTAENFRALCTGEKGVGVHGKPL
HYKGTRFHKAINHFMVQGGDIIKGDGTNGESIYGPTFEDENFNLERFD
*(35 a.a.)

- SilkBase 1999-2023 -