SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG13272_complete:A_SariMG_comp29909_c2_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000413 P protein peptidyl-prolyl isomerization
GO:0003755 F peptidyl-prolyl cis-trans isomerase activity
GO:0005528 F FK506 binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006457 P protein folding
GO:0006461 P protein-containing complex assembly
GO:0006810 P transport
GO:0006915 P apoptotic process
GO:0008134 F transcription factor binding
GO:0015031 P protein transport
GO:0016853 F isomerase activity
GO:0030331 F estrogen receptor binding
GO:0030544 F Hsp70 protein binding
GO:0031072 F heat shock protein binding
GO:0034389 P lipid droplet organization
GO:0042277 F peptide binding
GO:0042981 P regulation of apoptotic process
GO:0043065 P positive regulation of apoptotic process
GO:0045070 P positive regulation of viral genome replication
GO:0050714 P positive regulation of protein secretion
GO:0051879 F Hsp90 protein binding
GO:0061077 P chaperone-mediated protein folding
GO:0071492 P cellular response to UV-A
RNA-seq EntryA_SariMG_comp29909_c2_seq2
Sequence
(Amino Acid)
MNVNSGGQRNPLVYLDISIDAEQAGRIVIELRSDVVPKTAENFRALCTGEKGVGVHGKPL
HYKGTRFHKAINHFMVQGGDIIKGDGTNGESIYGPTFEDENFNLEHDVGVLSMANNGAPN
TNGSQFCITTGPSPQLDGTNVVFGSVRAGLGIAQEMERYECGDQCNLSVVSYHFNSMDAG
SSSPISIQPELFQ
*(63 a.a.)

- SilkBase 1999-2023 -