SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG13062_complete:A_SariMG_comp29846_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000118 C histone deacetylase complex
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001025 F RNA polymerase III general transcription initiation factor binding
GO:0001047 F core promoter sequence-specific DNA binding
GO:0001501 P skeletal system development
GO:0002076 P osteoblast development
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003714 F transcription corepressor activity
GO:0004407 F histone deacetylase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006954 P inflammatory response
GO:0007399 P nervous system development
GO:0008134 F transcription factor binding
GO:0008270 F zinc ion binding
GO:0008284 P positive regulation of cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0010592 P positive regulation of lamellipodium assembly
GO:0010832 P negative regulation of myotube differentiation
GO:0010882 P regulation of cardiac muscle contraction by calcium ion signaling
GO:0014894 P response to denervation involved in regulation of muscle adaptation
GO:0014898 P cardiac muscle hypertrophy in response to stress
GO:0014911 P positive regulation of smooth muscle cell migration
GO:0016568 P chromatin organization
GO:0016575 P histone deacetylation
GO:0016787 F hydrolase activity
GO:0017053 C transcription repressor complex
GO:0019901 F protein kinase binding
GO:0030017 C sarcomere
GO:0030018 C Z disc
GO:0030183 P B cell differentiation
GO:0030955 F potassium ion binding
GO:0031594 C neuromuscular junction
GO:0031672 C A band
GO:0032041 F NAD-dependent histone deacetylase activity (H3-K14 specific)
GO:0033235 P positive regulation of protein sumoylation
GO:0033558 F protein deacetylase activity
GO:0033613 F DNA-binding transcription factor binding
GO:0034983 P peptidyl-lysine deacetylation
GO:0040029 P regulation of gene expression, epigenetic
GO:0042113 P B cell activation
GO:0042493 P response to xenobiotic stimulus
GO:0042641 C actomyosin
GO:0042826 F histone deacetylase binding
GO:0043234 C protein-containing complex
GO:0043393 P regulation of protein binding
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0043525 P positive regulation of neuron apoptotic process
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045668 P negative regulation of osteoblast differentiation
GO:0045820 P negative regulation of glycolytic process
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048661 P positive regulation of smooth muscle cell proliferation
GO:0048742 P regulation of skeletal muscle fiber development
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0051153 P regulation of striated muscle cell differentiation
GO:0070491 F DNA-binding transcription factor binding
GO:0070555 P response to interleukin-1
GO:0070932 P histone H3 deacetylation
GO:0070933 P histone H4 deacetylation
GO:0071260 P cellular response to mechanical stimulus
GO:0071356 P cellular response to tumor necrosis factor
GO:0071374 P cellular response to parathyroid hormone stimulus
GO:1903428 P positive regulation of reactive oxygen species biosynthetic process
RNA-seq EntryA_SariMG_comp29846_c0_seq2
Sequence
(Amino Acid)
MYVINLADMAHEGASRTEGSPQHTPSPPHVPRLPPADTSFHHQIMQLKKQQQLQQEILLQ
HFQQQRQQLALEHENEMREHLKRWEQQKALEEAAQREAREAREAREARERHERDRVEHLR
KKEKHEPSANASTQVKQKLQEFLKKKQANANGTVPGSSYRNWGIVKSSSGESITSTGATA
THPYRLTAPLPLVLNAAPVQPSPADYPLRKTASEPNMLKVRLKARVIERRASPLARRPLK
PRVKHRNCEGGSPRGSPASGCSGGGGASGAAMPIREEEEACSRAAELLFSSPSLPNISLG
RAHVAAVPSRVHGHPAPPAAHTQHEERAPPFALARDLSWSHSPLNSASLPPVSEAEASCA
GPSPGPPSPAVARLGKRLLGRTHSAPLPLGDPALQTLQPPVAHQYLCKQIRKTVLIRAQD
AAAAQLREEEGEVIDLTSRRALPPEGAGPGAGGAVEPAPLARAFSSPLVGARAPPTGLAY
DPLMLKHGCGCGAHAPTHPEHGGRLQSVWARLCETGLAARTERTRPRKATFEDLQSVHTE
AHVSLFGGRGGGGAGVGGASVGGAECGAAGAGVAGAGAGPVRQLVRLACGGLGVDADTAW
SEAHTAGAARLAAGAVLDLALRTARGELKNGFAVVRPPGHHAEPNQAMGFCFFNNVAVAA
RILHTRLRLQRILIVDWDVHHGNGTQQIFYEDPHVLYMSIHRHDDGNFFPGTGAPTECGA
GPGLGYTVNVAWASGTNPPLADAEYLAAFRSIIMPIAKEYNPELVLVSCGFDAAGGHPAP
LGGYNVSAACFAQMTRDLMTLANGKVVLSLEGGYDLAAMCDCAQECVRALLGAGASAPTR
AELSRRPHVRAQDALRTAIAVNSAHWPVLKRYADLVAVSALEAQPLLAPHAPPPRVLAPP
DLQVERDAADTAAAMATLSMHHHHHHTLLPHRSPDSSRSVSEEPMEQDEGK
*(316 a.a.)

- SilkBase 1999-2023 -