SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG1241_complete:A_SariMG_comp15405_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
transcription_initiation_factor_TFIID_subunit_12_[Bombyx_mori]
Ontology
GO:0000125 C SAGA complex
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003713 F transcription coactivator activity
GO:0004402 F histone acetyltransferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005669 C transcription factor TFIID complex
GO:0006351 P transcription, DNA-templated
GO:0006352 P DNA-templated transcription, initiation
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0006368 P transcription elongation from RNA polymerase II promoter
GO:0008134 F transcription factor binding
GO:0030914 C SAGA complex
GO:0033276 C transcription factor TFTC complex
GO:0043966 P histone H3 acetylation
GO:0046982 F protein heterodimerization activity
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:1901796 P regulation of signal transduction by p53 class mediator
GO:1903506 P regulation of nucleic acid-templated transcription
RNA-seq EntryA_SariMG_comp15405_c0_seq1
Sequence
(Amino Acid)
MSNNTMNQAPNMPTIGNIGQGTIQYVNNPIQSPQLQSSIQGSPSQHSPMGTQSQVAIKSN
ASGGGDQSAQLLSRPRLQELVREVDPTVQLDEEVEEMLLQLADDFIDTTLNAACSVAKHR
HAPSVELRDVQLHLERQWNMWIPGFGNEELRPYKRAAVTEAHRQRMALIRKTIKKY
*(58 a.a.)

- SilkBase 1999-2023 -