SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG12401_complete:A_SariMG_comp29661_c1_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001525 P angiogenesis
GO:0001755 P neural crest cell migration
GO:0001842 P neural fold formation
GO:0001947 P heart looping
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007507 P heart development
GO:0008285 P negative regulation of cell population proliferation
GO:0008544 P epidermis development
GO:0009913 P epidermal cell differentiation
GO:0009953 P dorsal/ventral pattern formation
GO:0010719 P negative regulation of epithelial to mesenchymal transition
GO:0010837 P regulation of keratinocyte proliferation
GO:0010944 P negative regulation of transcription by competitive promoter binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045617 P negative regulation of keratinocyte differentiation
GO:0045618 P positive regulation of keratinocyte differentiation
GO:0045746 P negative regulation of Notch signaling pathway
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048557 P embryonic digestive tract morphogenesis
GO:0051726 P regulation of cell cycle
GO:0060214 P endocardium formation
GO:0060347 P heart trabecula formation
GO:0060716 P labyrinthine layer blood vessel development
GO:2000647 P negative regulation of stem cell proliferation
RNA-seq EntryA_SariMG_comp29661_c1_seq2
Sequence
(Amino Acid)
METTGINGMCRCCASEGAFKDIKRTYHWMGDEEVYGEMLKECFDIDLESIENSEGGICEV
CITQLRNASNFKKQVLQTEEQFKKQLQMKFFKPAVVKVETQEEDNQSDDNISNDDGFSGT
EFEVPIKTESAEDGKSKKRAAPTKASTSRTKKSKANEESADTSTTKHRGVATRSKERYKS
SSIEDDPPKLTLNKKTNFCSFISIRPVGKQSTKTVKERRQQRISYQKRLTELDWHFDNIR
TILNCSNATPMRGRVGTQFACSYCLSQFRDPADLKAHTIAMHSKNKPDFFSLRSLSKHIV
YLDITGLNCKICKEDIPGLQELMDHLKTEHEELIHKQIKNQIVPFKYEGRLLCTICDEDM
EPFSDLQDHVKEHFKNYTCEFCSSSFMIRCKMIEHKKAVHLV
*(133 a.a.)

- SilkBase 1999-2023 -