SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG12399_internal:A_SariMG_comp29661_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003714 F transcription corepressor activity
GO:0005166 F neurotrophin p75 receptor binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0043565 F sequence-specific DNA binding
GO:0046872 F metal ion binding
GO:1903507 P negative regulation of nucleic acid-templated transcription
RNA-seq EntryA_SariMG_comp29661_c0_seq1
Sequence
(Amino Acid)
KCDKCEKIFTSLEKKSIHFRRTHLGVTKRNVCQFCDERFSDYWKKVDHMVKEHGMAPVVF
KCQACDRTFNNQRMMNKHTKKDHLCERKHKCTECDMKFYDKSCLQRHMTKHTGL
(37 a.a.)

- SilkBase 1999-2023 -