SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG12278_complete:A_SariMG_comp29645_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001525 P angiogenesis
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006611 P protein export from nucleus
GO:0007010 P cytoskeleton organization
GO:0007026 P negative regulation of microtubule depolymerization
GO:0007275 P multicellular organism development
GO:0007424 P open tracheal system development
GO:0007427 P epithelial cell migration, open tracheal system
GO:0016334 P establishment or maintenance of polarity of follicular epithelium
GO:0016567 P protein ubiquitination
GO:0030154 P cell differentiation
GO:0030891 C VCB complex
GO:0035149 P lumen formation, open tracheal system
GO:0051297 P centrosome cycle
GO:0060438 P trachea development
GO:0061630 F ubiquitin protein ligase activity
GO:0090307 P mitotic spindle assembly
GO:1900037 P regulation of cellular response to hypoxia
RNA-seq EntryA_SariMG_comp29645_c0_seq2
Sequence
(Amino Acid)
MIEDGEDLYELNDNGERILIKSIDSNKRAYVRFTNCTTRPVDLWWRDFHGHRRRYVRLEP
GVFFDINTFLTHPWEFTDVGTGERFVINNKIIFRAPVNIADMRFRTNWNITVPVRSLRYS
AMLIVALWLPNEEAAARLDLPYLLESDIKQLMAKIRNRE
*(52 a.a.)

- SilkBase 1999-2023 -