SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG1226_complete:A_SariMG_comp15373_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_X-box-binding_protein_1_[Amyelois_transitella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001047 F core promoter sequence-specific DNA binding
GO:0001085 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001158 F cis-regulatory region sequence-specific DNA binding
GO:0001525 P angiogenesis
GO:0001889 P liver development
GO:0001934 P positive regulation of protein phosphorylation
GO:0001935 P endothelial cell proliferation
GO:0002020 F protease binding
GO:0002070 P epithelial cell maturation
GO:0002639 P positive regulation of immunoglobulin production
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006915 P apoptotic process
GO:0006986 P response to unfolded protein
GO:0006990 P positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response
GO:0007275 P multicellular organism development
GO:0007517 P muscle organ development
GO:0010506 P regulation of autophagy
GO:0010508 P positive regulation of autophagy
GO:0010832 P negative regulation of myotube differentiation
GO:0014065 P phosphatidylinositol 3-kinase signaling
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016049 P cell growth
GO:0019901 F protein kinase binding
GO:0030154 P cell differentiation
GO:0030176 C integral component of endoplasmic reticulum membrane
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0031017 P exocrine pancreas development
GO:0031062 P positive regulation of histone methylation
GO:0031490 F chromatin DNA binding
GO:0031625 F ubiquitin protein ligase binding
GO:0031647 P regulation of protein stability
GO:0031648 P protein destabilization
GO:0031670 P cellular response to nutrient
GO:0032008 P positive regulation of TOR signaling
GO:0032869 P cellular response to insulin stimulus
GO:0034599 P cellular response to oxidative stress
GO:0034976 P response to endoplasmic reticulum stress
GO:0035356 P cellular triglyceride homeostasis
GO:0035924 P cellular response to vascular endothelial growth factor stimulus
GO:0036312 F phosphatidylinositol 3-kinase regulatory subunit binding
GO:0042149 P cellular response to glucose starvation
GO:0042593 P glucose homeostasis
GO:0042632 P cholesterol homeostasis
GO:0042826 F histone deacetylase binding
GO:0042993 P obsolete positive regulation of transcription factor import into nucleus
GO:0043066 P negative regulation of apoptotic process
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045348 P positive regulation of MHC class II biosynthetic process
GO:0045579 P positive regulation of B cell differentiation
GO:0045582 P positive regulation of T cell differentiation
GO:0045600 P positive regulation of fat cell differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0048010 P vascular endothelial growth factor receptor signaling pathway
GO:0048666 P neuron development
GO:0051024 P positive regulation of immunoglobulin production
GO:0055089 P fatty acid homeostasis
GO:0055092 P sterol homeostasis
GO:0060612 P adipose tissue development
GO:0060691 P epithelial cell maturation involved in salivary gland development
GO:0070059 P intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0071222 P cellular response to lipopolysaccharide
GO:0071230 P cellular response to amino acid stimulus
GO:0071332 P cellular response to fructose stimulus
GO:0071333 P cellular response to glucose stimulus
GO:0071353 P cellular response to interleukin-4
GO:0071375 P cellular response to peptide hormone stimulus
GO:0071498 P cellular response to fluid shear stress
GO:0071499 P cellular response to laminar fluid shear stress
GO:1900100 P positive regulation of plasma cell differentiation
GO:1900102 P negative regulation of endoplasmic reticulum unfolded protein response
GO:1900103 P positive regulation of endoplasmic reticulum unfolded protein response
GO:1901800 P positive regulation of proteasomal protein catabolic process
GO:1901985 P positive regulation of protein acetylation
GO:1902236 P negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1903489 P positive regulation of lactation
GO:1990418 P response to insulin-like growth factor stimulus
GO:2000347 P positive regulation of hepatocyte proliferation
GO:2000353 P positive regulation of endothelial cell apoptotic process
GO:2000778 P positive regulation of interleukin-6 production
RNA-seq EntryA_SariMG_comp15373_c0_seq2
Sequence
(Amino Acid)
MSAPIIITVPKNYIMDDGDTKVVVDVTSPAPSRKRRLDHLSWEEKMQRKKLKNRVAAQTS
RDRKKAKMDDMDSQIKTFKEMNERLLSEVESLKALNERLLSENAALRSEAAARSVPEAQR
PAESTPRQKEGHPEAVRAARILLVMCLLSQTSSHTSILKSTSIPSINLQTPSSKRLMQVL
QERLKMSQSGTLESVLKDLKWWGPQQSNWNPMKVLS
*(71 a.a.)

- SilkBase 1999-2023 -