SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG12006_complete:A_SariMG_comp29568_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0002168 P instar larval development
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005700 C polytene chromosome
GO:0005703 C polytene chromosome puff
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007420 P brain development
GO:0007444 P imaginal disc development
GO:0007474 P imaginal disc-derived wing vein specification
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0008270 F zinc ion binding
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0019899 F enzyme binding
GO:0033128 P negative regulation of histone phosphorylation
GO:0035075 P response to ecdysone
GO:0035209 P pupal development
GO:0042800 F histone methyltransferase activity (H3-K4 specific)
GO:0044212 F transcription cis-regulatory region binding
GO:0044665 C MLL1/2 complex
GO:0044666 C MLL3/4 complex
GO:0046872 F metal ion binding
GO:0048096 P epigenetic maintenance of chromatin in transcription-competent conformation
GO:0048188 C Set1C/COMPASS complex
GO:0048813 P dendrite morphogenesis
GO:0051568 P histone H3-K4 methylation
GO:0051571 P positive regulation of histone H3-K4 methylation
RNA-seq EntryA_SariMG_comp29568_c0_seq3
Sequence
(Amino Acid)
MVRATHGVSRGCWYWESSIEELPEGAASRVGWGRRYANLQAPLGYDKFGYSWRSRKGTRF
HESRGKHYSNGYGEGDTLGFLIILPDSTSTKYTPNTYKDRPLVKFKSHLYYEDKDNIQES
LSNLKPLPGSKIYFFKNGECQGEAFIDIYQGCYYPTVSLHKNVTVSVNFGPNFKYPPATE
FPYRPMSEKAEEAICEQTMADLLYLTENEGKLRLDNFNL
*(72 a.a.)

- SilkBase 1999-2023 -