SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG11630_complete:A_SariMG_comp29474_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0006874 P cellular calcium ion homeostasis
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006986 P response to unfolded protein
GO:0006987 P obsolete activation of signaling protein activity involved in unfolded protein response
GO:0007029 P endoplasmic reticulum organization
GO:0008017 F microtubule binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019048 P modulation by virus of host process
GO:0019899 F enzyme binding
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0033149 F FFAT motif binding
GO:0042803 F protein homodimerization activity
GO:0044790 P suppression of viral release by host
GO:0044791 P obsolete positive regulation by host of viral release from host cell
GO:0044828 P negative regulation by host of viral genome replication
GO:0044829 P positive regulation by host of viral genome replication
GO:0045070 P positive regulation of viral genome replication
GO:0046725 P negative regulation by virus of viral protein levels in host cell
GO:0046982 F protein heterodimerization activity
GO:0048487 F beta-tubulin binding
GO:0090114 P COPII-coated vesicle budding
RNA-seq EntryA_SariMG_comp29474_c0_seq1
Sequence
(Amino Acid)
MPNQVLIIEPQNELKFKGLIEQGCTTYMRLTNPTNDTVLFKIKTTAPKKYCVRPNSGALE
PNSKLDIAITPQPVYVDPNEKHKHKFMVQSVIAPEGKTNVDQVWKEISPDQLMDYKLKCV
FETPRGTNLNDSGDNAAQNEVTKKRVSVIEEAKSANMISTPIMFENPVVDMQKVLSEVNH
LREEESKLRHENLQLKEELLLVRQMAIGEGRVARAHSYGPEKVQQVALMPWLATAIGMAV
IGIIVGKFFM
*(82 a.a.)

- SilkBase 1999-2023 -