SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG1151_3prime_partial:A_SariMG_comp15253_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
tyrosine_hydroxylase_[Samia_ricini]
Ontology
GO:0004497 F monooxygenase activity
GO:0004511 F tyrosine 3-monooxygenase activity
GO:0005506 F iron ion binding
GO:0005575 C cellular_component
GO:0006584 P catecholamine metabolic process
GO:0007619 P courtship behavior
GO:0008049 P male courtship behavior
GO:0008344 P adult locomotory behavior
GO:0009072 P aromatic amino acid family metabolic process
GO:0009611 P response to wounding
GO:0016491 F oxidoreductase activity
GO:0016714 F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0035220 P wing disc development
GO:0040040 P thermosensory behavior
GO:0042053 P regulation of dopamine metabolic process
GO:0042136 P neurotransmitter biosynthetic process
GO:0042416 P dopamine biosynthetic process
GO:0042417 P dopamine metabolic process
GO:0042423 P catecholamine biosynthetic process
GO:0043052 P thermotaxis
GO:0046872 F metal ion binding
GO:0048066 P developmental pigmentation
GO:0048067 P cuticle pigmentation
GO:0048082 P regulation of adult chitin-containing cuticle pigmentation
GO:0048085 P adult chitin-containing cuticle pigmentation
GO:0055114 P obsolete oxidation-reduction process
GO:2000274 P regulation of epithelial cell migration, open tracheal system
RNA-seq EntryA_SariMG_comp15253_c0_seq2
Sequence
(Amino Acid)
MAVAAAQKNREMFAIKKSYSIENGYPSRRRSLVDDARFETLVVKQTKQSVLEEARARAND
SGLDSDFIQDDSHIGIGDKSTVEDGSQQDDIKNIHLDYTLTE
(33 a.a.)

- SilkBase 1999-2023 -