SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG11517_complete:A_SariMG_comp29425_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0002020 F protease binding
GO:0002039 F p53 binding
GO:0002947 C tumor necrosis factor receptor superfamily complex
GO:0005515 F protein binding
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005768 C endosome
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006915 P apoptotic process
GO:0008270 F zinc ion binding
GO:0010008 C endosome membrane
GO:0010762 P regulation of fibroblast migration
GO:0010804 P negative regulation of tumor necrosis factor-mediated signaling pathway
GO:0016020 C membrane
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0019901 F protein kinase binding
GO:0031625 F ubiquitin protein ligase binding
GO:0032006 P regulation of TOR signaling
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0046872 F metal ion binding
GO:0055038 C recycling endosome membrane
GO:0061630 F ubiquitin protein ligase activity
GO:0070936 P protein K48-linked ubiquitination
GO:1901797 P negative regulation of signal transduction by p53 class mediator
GO:1902042 P negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:2001271 P negative regulation of cysteine-type endopeptidase activity involved in execution phase of apoptosis
RNA-seq EntryA_SariMG_comp29425_c0_seq1
Sequence
(Amino Acid)
MDNDAGRRQITLEQFSDMSQLEALSVKQLKELLTRNRVEFRGCLERAELLGRARTLWRNC
ARSEAEVDKLPLEECCKICMAAPLECVLLECGHIAACTGCAKQLAECPICRQYVVRAVRF
FRS
*(40 a.a.)

- SilkBase 1999-2023 -