SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG11452_complete:A_SariMG_comp29390_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000387 P spliceosomal snRNP assembly
GO:0000398 P mRNA splicing, via spliceosome
GO:0002164 P larval development
GO:0003723 F RNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005681 C spliceosomal complex
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006397 P mRNA processing
GO:0007274 P neuromuscular synaptic transmission
GO:0007275 P multicellular organism development
GO:0007417 P central nervous system development
GO:0007528 P neuromuscular junction development
GO:0008345 P larval locomotory behavior
GO:0008380 P RNA splicing
GO:0009790 P embryo development
GO:0015030 C Cajal body
GO:0017145 P stem cell division
GO:0019233 P sensory perception of pain
GO:0022618 P ribonucleoprotein complex assembly
GO:0030018 C Z disc
GO:0030240 P skeletal muscle thin filament assembly
GO:0031594 C neuromuscular junction
GO:0031674 C I band
GO:0032224 P positive regulation of synaptic transmission, cholinergic
GO:0032797 C SMN complex
GO:0033962 P P-body assembly
GO:0034718 C SMN-Gemin2 complex
GO:0034730 C SmD-containing SMN-Sm protein complex
GO:0035154 P terminal cell fate specification, open tracheal system
GO:0042802 F identical protein binding
GO:0045175 P basal protein localization
GO:0048601 P oocyte morphogenesis
GO:0048863 P stem cell differentiation
GO:0051276 P chromosome organization
GO:0051393 F alpha-actinin binding
GO:0060079 P excitatory postsynaptic potential
GO:0071254 C cytoplasmic U snRNP body
GO:0072089 P stem cell proliferation
GO:0072553 P terminal button organization
GO:0097113 P AMPA glutamate receptor clustering
GO:0097504 C Gemini of coiled bodies
GO:0098794 C postsynapse
GO:1990194 P cytoplasmic U snRNP body assembly
RNA-seq EntryA_SariMG_comp29390_c0_seq2
Sequence
(Amino Acid)
MSKSEVLYMKGMNTSESDGDCEDIWDDKKLNDAYDKALRIANVEVAKRVAMSTNTERNKE
GDTKNKKGKSSKPSSSKKDVEWKTGMPCRAIYEGDGLEYEAFLLRTINDKECVVRFLGYE
NSEIVLISSLKQTLGNDERTRQIERALSEKADDGFGSQSPHCEGMEFGSDRIPSPTSTEK
SFQRKKTSKTKKKQSGQQSKDFALPEINIPNMSMLNNLGSMDMPMPPPPPFNFANHNRTE
CEDQAISSMLLSWYMSGYYTGLYQGMKRSKENRKNM
*(91 a.a.)

- SilkBase 1999-2023 -