Name | O_SariMG11437_complete:A_SariMG_comp29382_c1_seq1 |
Scaffold_id | |
NCBI non-redundant (nr) | |
Ontology |
GO:0000226 |
P |
microtubule cytoskeleton organization |
GO:0000910 |
P |
cytokinesis |
GO:0003676 |
F |
nucleic acid binding |
GO:0003677 |
F |
DNA binding |
GO:0003723 |
F |
RNA binding |
GO:0005515 |
F |
protein binding |
GO:0005634 |
C |
nucleus |
GO:0005654 |
C |
nucleoplasm |
GO:0006351 |
P |
transcription, DNA-templated |
GO:0006355 |
P |
regulation of transcription, DNA-templated |
GO:0006397 |
P |
mRNA processing |
GO:0007049 |
P |
cell cycle |
GO:0008380 |
P |
RNA splicing |
GO:0016607 |
C |
nuclear speck |
GO:0043066 |
P |
negative regulation of apoptotic process |
GO:0043484 |
P |
regulation of RNA splicing |
GO:0044822 |
F |
RNA binding |
GO:0050733 |
F |
RS domain binding |
GO:0051726 |
P |
regulation of cell cycle |
|
RNA-seq Entry | A_SariMG_comp29382_c1_seq1 |
Sequence (Amino Acid) | MIFANLCTRNQEDQLQRAAPVESGMGMHLLQKMGWTPGQGLGKEGTGTLQPLLLEVKLDT
RGLQAKEEYSGRYSKGMKPPRPGGRLRGGSVPLVAGGKHPVSLLGEYCSKQKLGPPEYNL
CFECGPDHKKNFLFKVNVAGIEYQPAVASANKKQAKADAAQLALQKLGILT
*(56 a.a.) |