SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG11420_complete:A_SariMG_comp29376_c0_seq6
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0000187 P obsolete activation of MAPK activity
GO:0000785 C chromatin
GO:0001933 P negative regulation of protein phosphorylation
GO:0001934 P positive regulation of protein phosphorylation
GO:0002031 P G protein-coupled receptor internalization
GO:0002092 P positive regulation of receptor internalization
GO:0004402 F histone acetyltransferase activity
GO:0004857 F enzyme inhibitor activity
GO:0005096 F GTPase activator activity
GO:0005159 F insulin-like growth factor receptor binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005765 C lysosomal membrane
GO:0005829 C cytosol
GO:0005834 C heterotrimeric G-protein complex
GO:0005886 C plasma membrane
GO:0005905 C clathrin-coated pit
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006810 P transport
GO:0006897 P endocytosis
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007602 P phototransduction
GO:0008134 F transcription factor binding
GO:0008277 P regulation of G protein-coupled receptor signaling pathway
GO:0009968 P negative regulation of signal transduction
GO:0014069 C postsynaptic density
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016023 C cytoplasmic vesicle
GO:0016323 C basolateral plasma membrane
GO:0016567 P protein ubiquitination
GO:0030168 P platelet activation
GO:0030331 F estrogen receptor binding
GO:0030659 C cytoplasmic vesicle membrane
GO:0031143 C pseudopodium
GO:0031397 P negative regulation of protein ubiquitination
GO:0031398 P positive regulation of protein ubiquitination
GO:0031410 C cytoplasmic vesicle
GO:0031434 F mitogen-activated protein kinase kinase binding
GO:0031625 F ubiquitin protein ligase binding
GO:0031691 F alpha-1A adrenergic receptor binding
GO:0031692 F alpha-1B adrenergic receptor binding
GO:0031701 F angiotensin receptor binding
GO:0031762 F follicle-stimulating hormone receptor binding
GO:0031896 F V2 vasopressin receptor binding
GO:0032088 P negative regulation of NF-kappaB transcription factor activity
GO:0032092 P positive regulation of protein binding
GO:0032715 P negative regulation of interleukin-6 production
GO:0032717 P negative regulation of interleukin-8 production
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0034260 P negative regulation of GTPase activity
GO:0034393 P positive regulation of smooth muscle cell apoptotic process
GO:0035025 P positive regulation of Rho protein signal transduction
GO:0035066 P positive regulation of histone acetylation
GO:0035612 F AP-2 adaptor complex binding
GO:0035615 F clathrin adaptor activity
GO:0035774 P positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0036276 P response to antidepressant
GO:0042699 P follicle-stimulating hormone signaling pathway
GO:0042995 C cell projection
GO:0043027 F cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0043149 P stress fiber assembly
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043197 C dendritic spine
GO:0043280 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043547 P positive regulation of GTPase activity
GO:0044212 F transcription cis-regulatory region binding
GO:0044325 F transmembrane transporter binding
GO:0045211 C postsynaptic membrane
GO:0045309 F protein phosphorylated amino acid binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0051219 F phosphoprotein binding
GO:0070373 P negative regulation of ERK1 and ERK2 cascade
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0090240 P positive regulation of histone H4 acetylation
RNA-seq EntryA_SariMG_comp29376_c0_seq6
Sequence
(Amino Acid)
MEDGGSNKQRQATRVFKKSSPNGKITVYLGKRDFVDHITHVDPIDGVVLIDPEYVKDRKV
FGHVLAAFRYGREDLDVLGLTFRKDLYLAAEQIFPTTSAPKRPLTRLQERLVRKLGPAAH
PFYFELPPHCPASVTLQPAPGDTGKPCGVDYELKAFVADTQDDKPHKRNSVRLAIRKIMY
APSKQGEQPSVEVSKEFMMSPNKLYLEASLDKELYHHGENIAVNVHIANNSNRSVKRIKV
SVRQFADICLFSTAQYKCTVAEAESEEGCPVGPGFTLSKVFTLTPLLANNKDKWGLALDG
QLKHEDTNLASSTLIADPSQRENLGIIVQYKVKVKLCLGPLGG
*(113 a.a.)

- SilkBase 1999-2023 -