SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG11313_3prime_partial:A_SariMG_comp29339_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000723 P telomere maintenance
GO:0000724 P double-strand break repair via homologous recombination
GO:0000781 C chromosome, telomeric region
GO:0000784 C chromosome, telomeric region
GO:0000785 C chromatin
GO:0003677 F DNA binding
GO:0003684 F damaged DNA binding
GO:0003697 F single-stranded DNA binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005662 C DNA replication factor A complex
GO:0006260 P DNA replication
GO:0006281 P DNA repair
GO:0006284 P base-excision repair
GO:0006289 P nucleotide-excision repair
GO:0006298 P mismatch repair
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0010569 P regulation of double-strand break repair via homologous recombination
GO:0016605 C PML body
GO:0019899 F enzyme binding
GO:0019903 F protein phosphatase binding
GO:0031571 P mitotic G1 DNA damage checkpoint signaling
GO:0031625 F ubiquitin protein ligase binding
GO:0035861 C site of double-strand break
GO:0047485 F protein N-terminus binding
GO:2000001 P regulation of DNA damage checkpoint
RNA-seq EntryA_SariMG_comp29339_c0_seq1
Sequence
(Amino Acid)
MWNDQSAIGGGFFNSPSQFGNANTTNQPQKNEGRRASRTAPIVIKQALHSGDDGIKIWGT
EIQIISIVARVRNIKIQSIKIVYTIQDITGRMKAVMWLDQEAMDEDEKAIPK
(36 a.a.)

- SilkBase 1999-2023 -