SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG11083_3prime_partial:A_SariMG_comp29276_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001085 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003677 F DNA binding
GO:0003713 F transcription coactivator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005719 C euchromatin
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007517 P muscle organ development
GO:0008134 F transcription factor binding
GO:0010628 P positive regulation of gene expression
GO:0017022 F myosin binding
GO:0031453 P positive regulation of heterochromatin assembly
GO:0035060 C brahma complex
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048666 P neuron development
GO:0048813 P dendrite morphogenesis
GO:0070604 C RSC-type complex
RNA-seq EntryA_SariMG_comp29276_c0_seq2
Sequence
(Amino Acid)
MNSFLLSTANQQEIQGLDSKIHETVDTINQLKTNREFFLSFSKDPQRFTQKWLVSQARDL
KTMSGAGGNPEEERLGTFYAQPWAGEGVARYLHARLAARRRDLEHALHAPPSAAAAAGAA
VAAPGAPA
(41 a.a.)

- SilkBase 1999-2023 -