SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG11068_3prime_partial:A_SariMG_comp29268_c1_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0002115 P store-operated calcium entry
GO:0005509 F calcium ion binding
GO:0005513 P detection of calcium ion
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0007155 P cell adhesion
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0012505 C endomembrane system
GO:0015279 F store-operated calcium channel activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0022416 P chaeta development
GO:0032237 P activation of store-operated calcium channel activity
GO:0046872 F metal ion binding
GO:0048763 F calcium-induced calcium release activity
GO:0051209 P release of sequestered calcium ion into cytosol
GO:0051533 P positive regulation of calcineurin-NFAT signaling cascade
GO:0051924 P regulation of calcium ion transport
GO:0070588 P calcium ion transmembrane transport
GO:1903779 P regulation of cardiac conduction
RNA-seq EntryA_SariMG_comp29268_c1_seq2
Sequence
(Amino Acid)
MRFGIILYWCVFIFHLCQANDVERTEPRDGGRREKWGPTRNGPFASDLAVTASNEQILVE
ACQSEPACLQDHAGLEAITQLHHQLDDDANGNVDLSESDDFLREELQYDSGYEKRQRAFH
HNDDMHISVKELWEAWLRSEVHNWTAEQTVDWLSQSVDLPQYRTLFLQHKVTGATLPRLA
VNNMQYLSNVLGAGRGER
(65 a.a.)

- SilkBase 1999-2023 -