SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG1079_complete:A_SariMG_comp15134_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)		hypothetical_protein_RR46_12908_[Papilio_xuthus]
Ontology
GO:0000059 P obsolete protein import into nucleus, docking
GO:0000060 P obsolete protein import into nucleus, translocation
GO:0005635 C nuclear envelope
GO:0005643 C nuclear pore
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005811 C lipid droplet
GO:0005875 C microtubule associated complex
GO:0006606 P protein import into nucleus
GO:0006607 P NLS-bearing protein import into nucleus
GO:0006610 P ribosomal protein import into nucleus
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0007015 P actin filament organization
GO:0007067 P mitotic cell cycle
GO:0007304 P chorion-containing eggshell formation
GO:0008139 F nuclear localization sequence binding
GO:0008320 F protein transmembrane transporter activity
GO:0008360 P regulation of cell shape
GO:0008536 F small GTPase binding
GO:0008565 F obsolete protein transporter activity
GO:0015031 P protein transport
GO:0031965 C nuclear membrane
GO:0034399 C nuclear periphery
GO:0043186 C P granule
GO:0051533 P positive regulation of calcineurin-NFAT signaling cascade
GO:0071806 P protein transmembrane transport
RNA-seq EntryA_SariMG_comp15134_c0_seq2
Sequence
(Amino Acid)
MEPYMERALCPISLNAINSEIDEIALEGINFWLNVIQKEINFAIEESNAAAAGRSPIGIS
RFYVRSALKYLAPTLIQKLNKDDDTDFELEWSPPKAVSMCLMLLLTCYEDEIVEHMLPFI
DLKIKSTTWRYKAAAASAFDTVFGGVQPNTLKLFI
*(51 a.a.)

- SilkBase 1999-2023 -