SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG10588_complete:A_SariMG_comp29049_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001503 P ossification
GO:0001525 P angiogenesis
GO:0001541 P ovarian follicle development
GO:0001666 P response to hypoxia
GO:0001935 P endothelial cell proliferation
GO:0001958 P endochondral ossification
GO:0004222 F metalloendopeptidase activity
GO:0005178 F integrin binding
GO:0005509 F calcium ion binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006508 P proteolysis
GO:0006979 P response to oxidative stress
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0008270 F zinc ion binding
GO:0008584 P male gonad development
GO:0009612 P response to mechanical stimulus
GO:0009725 P response to hormone
GO:0010831 P positive regulation of myotube differentiation
GO:0010952 P positive regulation of peptidase activity
GO:0014070 P response to organic cyclic compound
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016477 P cell migration
GO:0016504 F peptidase activator activity
GO:0016787 F hydrolase activity
GO:0030307 P positive regulation of cell growth
GO:0030324 P lung development
GO:0030335 P positive regulation of cell migration
GO:0030574 P collagen catabolic process
GO:0031012 C extracellular matrix
GO:0031410 C cytoplasmic vesicle
GO:0031638 P zymogen activation
GO:0035987 P endodermal cell differentiation
GO:0035988 P chondrocyte proliferation
GO:0042470 C melanosome
GO:0043615 P astrocyte cell migration
GO:0043627 P response to estrogen
GO:0044354 C macropinosome
GO:0045579 P positive regulation of B cell differentiation
GO:0045746 P negative regulation of Notch signaling pathway
GO:0046872 F metal ion binding
GO:0048701 P embryonic cranial skeleton morphogenesis
GO:0048754 P branching morphogenesis of an epithelial tube
GO:0048771 P tissue remodeling
GO:0051895 P negative regulation of focal adhesion assembly
GO:0060348 P bone development
GO:0097094 P craniofacial suture morphogenesis
RNA-seq EntryA_SariMG_comp29049_c0_seq3
Sequence
(Amino Acid)
MSISQRSLEVTIFNMAVFNLRSSLRIVWAVVAAFVFLTRSSAAPTFGSTDKATMYLAQYG
YLSPSVRNPSSGHIMDESSWRRAIAEFQSFAGLNATGDLDDETTKMMSLPRCGVRDKVGF
GESRAKRYALQGSRWRVKNLTYKISKYPSRLNRAEVDAELAKAFSVWSGYTDLTFTQKRS
GQVHIEIRFEKGEHGDGDPFDGPGGTLAHAYFPVYGGDAHFDDAEMWSINSRRGTNLFQV
AAHEFGHSLGLSHSDVRSALMAPFYRGFDPAFQLDQDDIQGIQALYGHKSQTDIGGGVGG
GGIIPSVPRATTQQPSAEDPTLCADSRIDTIFNSADGGTFVFKGEHYWRLTEDGVAAGYP
RLIARAWPGLPGNIDAAFTYKNGKTYFFKGSKYWRYNGQKMDGDYPKEISEGFTGIPDNI
DAALVWSGNGKIYFYKGSKFWRFDPAQRPPVKATYPKPLSNWEGIPDSIDAALQYTNGYT
YFFKGGSYWRFNDRTFSVDADNPQFPRSTAFWWLGCSSAPRGTVGGNQRLTDIPAADDDV
GDITFDAVVNVQSDGARL
*(185 a.a.)

- SilkBase 1999-2023 -