SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG10578_complete:A_SariMG_comp29044_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0003674 F molecular_function
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0006909 P phagocytosis
GO:0007275 P multicellular organism development
GO:0007614 P short-term memory
GO:0007616 P long-term memory
GO:0009994 P oocyte differentiation
GO:0010494 C cytoplasmic stress granule
GO:0010603 P regulation of cytoplasmic mRNA processing body assembly
GO:0022008 P neurogenesis
GO:0022416 P chaeta development
GO:0030833 P regulation of actin filament polymerization
GO:0032092 P positive regulation of protein binding
GO:0034063 P stress granule assembly
GO:0042051 P compound eye photoreceptor development
GO:0044822 F RNA binding
GO:0045475 P locomotor rhythm
GO:0046959 P habituation
GO:0048749 P compound eye development
GO:0051823 P regulation of synapse structural plasticity
GO:0060965 P negative regulation of gene silencing by miRNA
GO:0090328 P regulation of olfactory learning
GO:0097167 P circadian regulation of translation
GO:1901216 P positive regulation of neuron death
RNA-seq EntryA_SariMG_comp29044_c0_seq2
Sequence
(Amino Acid)
MNNKRKSRQGPPRSPRGRVVAEGVYNNAYFMHAVTSHVGDTVQVLTQSGSLWEGVFKTFS
PQFEVVLEVAHRVDQEGTVPVDSVVEKLIFKPQDVVSIRAKDSDLEYATLDVFQTDSAIS
SKFNGECVVYIVFIYY
*(44 a.a.)

- SilkBase 1999-2023 -