SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG10567_internal:A_SariMG_comp29042_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000790 C chromatin
GO:0000791 C euchromatin
GO:0000792 C heterochromatin
GO:0000987 F cis-regulatory region sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005657 C replication fork
GO:0005720 C heterochromatin
GO:0006281 P DNA repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0008270 F zinc ion binding
GO:0008283 P cell population proliferation
GO:0008327 F methyl-CpG binding
GO:0010216 P maintenance of DNA methylation
GO:0010390 P histone monoubiquitination
GO:0016363 C nuclear matrix
GO:0016567 P protein ubiquitination
GO:0016568 P chromatin organization
GO:0016574 P histone ubiquitination
GO:0016874 F ligase activity
GO:0031493 F obsolete nucleosomal histone binding
GO:0032270 P positive regulation of cellular protein metabolic process
GO:0035064 F methylated histone binding
GO:0042393 F histone binding
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0042802 F identical protein binding
GO:0044729 F hemi-methylated DNA-binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0051865 P protein autoubiquitination
GO:0061630 F ubiquitin protein ligase activity
GO:0090308 P regulation of DNA methylation-dependent heterochromatin assembly
GO:2000373 P positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity
RNA-seq EntryA_SariMG_comp29042_c1_seq1
Sequence
(Amino Acid)
DEDSKLYCKLKEIRPRARSIIKIKDLNIGQQIMVNYNPEEPLEKGFWFDFKVAEIKKLRV
NYELVGTLYLGADAVPQHDTKIKVQDNIYAIEDIVPLNERTIEYNKRMEIVPDKRSMPLN
CLSCRDNDEVLCKDCGCFVCLGKESPDKIVLCDECNYGYHMTCLNPPLSDLPEEDWYCPL
CKRDPNKVVAPGAAKQTKKSSSASKGSRDWGRGMACIGKTKSCAMPANHFGPIPGIEVGM
CWRFRIQLSESGVHRPPVSGIHGRDIEGAYSIVLSGGYEDDVDNGNEFTYTGSGGRDLSG
NKRTAEQSCDQTLTRENKALARNCAANRISEEGGDAGKNWREGKPVRVVRSYKMLKHFPK
YAPKEGIRYDGIYKVVKYYPEKGLSGFRVWKYLLRRDDPSPAPWEAELNFPIIYPDGYLE
AEAEKKALKEKSLKNTKGKTKKRALRESNHTTESEGELSPPVKKKKVQTKNENKLKK
(158 a.a.)

- SilkBase 1999-2023 -