SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG10519_3prime_partial:A_SariMG_comp29026_c1_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000731 P DNA synthesis involved in DNA repair
GO:0003677 F DNA binding
GO:0003684 F damaged DNA binding
GO:0003887 F DNA-directed DNA polymerase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006260 P DNA replication
GO:0006281 P DNA repair
GO:0006282 P regulation of DNA repair
GO:0006290 P pyrimidine dimer repair
GO:0006301 P postreplication repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0010225 P response to UV-C
GO:0016740 F transferase activity
GO:0016779 F nucleotidyltransferase activity
GO:0019985 P translesion synthesis
GO:0046872 F metal ion binding
GO:0070987 P error-free translesion synthesis
GO:0071494 P cellular response to UV-C
GO:0071897 P DNA biosynthetic process
RNA-seq EntryA_SariMG_comp29026_c1_seq2
Sequence
(Amino Acid)
MVPNTYALGYDNFEEFVSDVCTHGSDSIDFDHNHASMLLVGAVIVSEIRAAVYEETGYRC
SAGIAHNKILAKLVCGMNKPNKQTVLPKHCIDILYKTLSVKKVKHLGGKFGDYVCERLKI
NTMGELQNFSEKDLQSKFDEKNGLSLFLFL
(49 a.a.)

- SilkBase 1999-2023 -