SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG10517_internal:A_SariMG_comp29024_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001669 C acrosomal vesicle
GO:0004040 F amidase activity
GO:0004252 F serine-type endopeptidase activity
GO:0005515 F protein binding
GO:0005537 F mannose binding
GO:0005634 C nucleus
GO:0005798 C Golgi-associated vesicle
GO:0006508 P proteolysis
GO:0007190 P activation of adenylate cyclase activity
GO:0007338 P single fertilization
GO:0007339 P binding of sperm to zona pellucida
GO:0007340 P acrosome reaction
GO:0007341 P penetration of zona pellucida
GO:0008144 F obsolete drug binding
GO:0008233 F peptidase activity
GO:0008236 F serine-type peptidase activity
GO:0016787 F hydrolase activity
GO:0042806 F fucose binding
GO:0043159 C acrosomal matrix
GO:0043234 C protein-containing complex
GO:0048545 P response to steroid hormone
RNA-seq EntryA_SariMG_comp29024_c1_seq1
Sequence
(Amino Acid)
LQCAVFLATIVLALAEEPLLRYHENIGIPLAERIRQTEQAINFDGSRITGGSPAPLGAYP
YLIGQLNHLTTGQTSVCGSSMLSNTVAVTAAHCWYDGWSQAIQLTLVFG
(35 a.a.)

- SilkBase 1999-2023 -