SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG10501_complete:A_SariMG_comp29021_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0001501 P skeletal system development
GO:0001503 P ossification
GO:0001525 P angiogenesis
GO:0002063 P chondrocyte development
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004694 F eukaryotic translation initiation factor 2alpha kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0006412 P translation
GO:0006417 P regulation of translation
GO:0006468 P protein phosphorylation
GO:0006919 P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006983 P ER overload response
GO:0006986 P response to unfolded protein
GO:0007029 P endoplasmic reticulum organization
GO:0007595 P lactation
GO:0009967 P positive regulation of signal transduction
GO:0010575 P positive regulation of vascular endothelial growth factor production
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0010998 P regulation of translational initiation by eIF2 alpha phosphorylation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0017148 P negative regulation of translation
GO:0018105 P peptidyl-serine phosphorylation
GO:0019217 P regulation of fatty acid metabolic process
GO:0019722 P calcium-mediated signaling
GO:0019899 F enzyme binding
GO:0019903 F protein phosphatase binding
GO:0030282 P bone mineralization
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0031016 P pancreas development
GO:0031018 P endocrine pancreas development
GO:0031642 P negative regulation of myelination
GO:0032092 P positive regulation of protein binding
GO:0032933 P SREBP signaling pathway
GO:0034198 P cellular response to amino acid starvation
GO:0034976 P response to endoplasmic reticulum stress
GO:0036492 P eiF2alpha phosphorylation in response to endoplasmic reticulum stress
GO:0036499 P PERK-mediated unfolded protein response
GO:0042149 P cellular response to glucose starvation
GO:0042802 F identical protein binding
GO:0043066 P negative regulation of apoptotic process
GO:0045444 P fat cell differentiation
GO:0045943 P positive regulation of transcription by RNA polymerase I
GO:0046777 P protein autophosphorylation
GO:0048009 P insulin-like growth factor receptor signaling pathway
GO:0051260 P protein homooligomerization
GO:0060734 P regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
GO:0070059 P intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0070417 P cellular response to cold
GO:0071074 F eukaryotic initiation factor eIF2 binding
GO:1900182 P positive regulation of protein localization to nucleus
GO:1902010 P negative regulation of translation in response to endoplasmic reticulum stress
GO:1902235 P regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1902237 P positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1903788 P positive regulation of glutathione biosynthetic process
GO:1990440 P positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
RNA-seq EntryA_SariMG_comp29021_c0_seq1
Sequence
(Amino Acid)
MSDWFWRVIALKAAFALTFFVCNLRADDAVQKLPFCNPSNAKDSPVYNDLVIVSTLDGRL
TAFSTQNGAKAWDLETQPLLSSNLHHVELTSGGKWVRLVPSLRGTLYSLSGDTIEPLPFD
TEQLLSSSYKYSDDLVVAGARETLWFGLDSNTGSVIYECGSSGCNSEQERVSAGRDVLVL
RRLSSTVRALDPRTGTEKWNYSVAEHDVAVSRRECVGPRGGAPSPVHVSVALHEGLVALA
TEGERRQLWQHKLEAPVAGMWRLYEGSLHNIDVMWEATQTLIEGGVTQQPSLYIGSHQTQ
LYIQESRFYARKLETAVAANPVPWKLVTARPLIGSGGGNAETALTVKDPDSNKLSLVTLY
GNGGPVADHGFFLYIQDTCDQAVQVTEDAIDADSSPNNSREQPDYHHIHVHVYSLWFWWK
EVLLIAVSSALLMNLMIWPRFFARKLPASPLPMNRDFGVVKYRHFEKPPSLPEYSGRYEM
DFTPLRCLGKGGFGVVFEARNNIDHCSYAVKRITLPKDESKRERVLREVRALAKLEHEHI
VRYFNAWVEQPPPLWQQNRDRLWMQELEGVSVAMSDEYTPTNSPPAKHRPRDGSVTLNLH
KCADDALGSAHDGNKLAEPKRLRSLSCNDSISIVFEENASKPHLVEYSKNSSEPPPVYRH
TTEDDSYIVFAESEHSGLGSGKMPNSSSPGKPSDGSIDSSSPGKPSNGSVELSEAKKNSS
FDKRLERVKQCDVDSPTTPSKKNKKGHTRHWSLDTCVRSASENSAAAPNMYLYIQMQLCL
SDSLHDWLRNNRTCEARADNAKNLFSQIVSAVEYVHLAGLIHRDLKPSNILFAPDGRVKV
GDFGLVTHIADADADAAADADTYADKGAGVSGGRHAQHRHTYRVGTHLYMSPEQLQSRRY
GYKVDIYSLGIILFELLQPFGTEAERVSCLMRLRDHHYPQDFQEKYPNEVGLLKMMLSED
PRKRPTASGVRARAPLFHFTDSRYHFTLPPAPPSVPTLPTAPVTA
*(334 a.a.)

- SilkBase 1999-2023 -