SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG10407_complete:A_SariMG_comp28990_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001516 P prostaglandin biosynthetic process
GO:0001934 P positive regulation of protein phosphorylation
GO:0002376 P immune system process
GO:0002906 P negative regulation of mature B cell apoptotic process
GO:0004167 F dopachrome isomerase activity
GO:0005102 F signaling receptor binding
GO:0005125 F cytokine activity
GO:0005126 F cytokine receptor binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006954 P inflammatory response
GO:0007166 P cell surface receptor signaling pathway
GO:0007569 P cell aging
GO:0008283 P cell population proliferation
GO:0009986 C cell surface
GO:0010629 P negative regulation of gene expression
GO:0010739 P positive regulation of protein kinase A signaling
GO:0016853 F isomerase activity
GO:0019752 P carboxylic acid metabolic process
GO:0030330 P DNA damage response, signal transduction by p53 class mediator
GO:0030890 P positive regulation of B cell proliferation
GO:0031666 P positive regulation of lipopolysaccharide-mediated signaling pathway
GO:0031982 C vesicle
GO:0032269 P negative regulation of cellular protein metabolic process
GO:0033033 P negative regulation of myeloid cell apoptotic process
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0042056 F chemoattractant activity
GO:0042127 P regulation of cell population proliferation
GO:0042327 P positive regulation of phosphorylation
GO:0043066 P negative regulation of apoptotic process
GO:0043209 C myelin sheath
GO:0043406 P positive regulation of MAP kinase activity
GO:0043518 P negative regulation of DNA damage response, signal transduction by p53 class mediator
GO:0045087 P innate immune response
GO:0048146 P positive regulation of fibroblast proliferation
GO:0050178 F phenylpyruvate tautomerase activity
GO:0050715 P positive regulation of cytokine production
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0050918 P positive chemotaxis
GO:0061078 P positive regulation of prostaglandin secretion involved in immune response
GO:0061081 P positive regulation of myeloid leukocyte cytokine production involved in immune response
GO:0070062 C extracellular exosome
GO:0070207 P protein homotrimerization
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0071157 P regulation of cell cycle
GO:0090238 P positive regulation of arachidonic acid secretion
GO:0090344 P negative regulation of cell aging
GO:1902166 P negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:2000343 P positive regulation of chemokine (C-X-C motif) ligand 2 production
RNA-seq EntryA_SariMG_comp28990_c0_seq1
Sequence
(Amino Acid)
MPHFRIETNVPKSKIPVDFVTKAVPVLAKALGKPDQYCVVSVIPDVAMSFGGTTEPCAIA
NLMSIGALGVEQNKKHAKVLFELVEKELGIQNDRMYITFQDEPTGNVGFKGTTFHAIFG
*(39 a.a.)

- SilkBase 1999-2023 -