SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG10366_5prime_partial:A_SariMG_comp28982_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001030 F RNA polymerase III type 1 promoter sequence-specific DNA binding
GO:0001031 F RNA polymerase III type 2 promoter sequence-specific DNA binding
GO:0001032 F RNA polymerase III type 3 promoter sequence-specific DNA binding
GO:0001156 F TFIIIC-class transcription factor complex binding
GO:0001938 P positive regulation of endothelial cell proliferation
GO:0005515 F protein binding
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005829 C cytosol
GO:0007050 P regulation of cell cycle
GO:0008361 P regulation of cell size
GO:0016049 P cell growth
GO:0016236 P macroautophagy
GO:0019901 F protein kinase binding
GO:0030425 C dendrite
GO:0031669 P cellular response to nutrient levels
GO:0031929 P TOR signaling
GO:0031931 C TORC1 complex
GO:0032008 P positive regulation of TOR signaling
GO:0032403 F protein-containing complex binding
GO:0042325 P regulation of phosphorylation
GO:0043025 C neuronal cell body
GO:0043231 C intracellular membrane-bounded organelle
GO:0045945 P positive regulation of transcription by RNA polymerase III
GO:0071230 P cellular response to amino acid stimulus
GO:0071889 F 14-3-3 protein binding
GO:0071902 P positive regulation of protein serine/threonine kinase activity
GO:1900034 P regulation of cellular response to heat
RNA-seq EntryA_SariMG_comp28982_c0_seq2
Sequence
(Amino Acid)
ASSTPPAALVRWCARRRSLALAGPSPLIRIWDAHRELHAADIHTECDSSVTSLWRGSEVG
GCGEAGSGAEEVTVCGFADGSVRGWDERAPSGPLYTLHQHSAVVLCAAVRPAHYTLVTGC
AGGEVRLYDTRKLTVREEVRVPAPPLTAVDVHPLCGIIAW
*(52 a.a.)

- SilkBase 1999-2023 -