SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG10235_complete:A_SariMG_comp28938_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001948 F protein binding
GO:0002091 P negative regulation of receptor internalization
GO:0005109 F frizzled binding
GO:0005137 F interleukin-5 receptor binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005895 C interleukin-5 receptor complex
GO:0005912 C adherens junction
GO:0005925 C focal adhesion
GO:0006612 P protein targeting to membrane
GO:0006930 P substrate-dependent cell migration, cell extension
GO:0007265 P Ras protein signal transduction
GO:0007268 P chemical synaptic transmission
GO:0007346 P regulation of mitotic cell cycle
GO:0008022 F protein C-terminus binding
GO:0008093 F cytoskeletal anchor activity
GO:0008284 P positive regulation of cell population proliferation
GO:0010718 P positive regulation of epithelial to mesenchymal transition
GO:0010862 P positive regulation of pathway-restricted SMAD protein phosphorylation
GO:0016020 C membrane
GO:0019838 F growth factor binding
GO:0030036 P actin cytoskeleton organization
GO:0030054 C cell junction
GO:0030307 P positive regulation of cell growth
GO:0030335 P positive regulation of cell migration
GO:0030511 P positive regulation of transforming growth factor beta receptor signaling pathway
GO:0032435 P negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035556 P intracellular signal transduction
GO:0042043 F neurexin family protein binding
GO:0042327 P positive regulation of phosphorylation
GO:0042470 C melanosome
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0045121 C membrane raft
GO:0045545 F syndecan binding
GO:0046330 P positive regulation of JNK cascade
GO:0046875 F ephrin receptor binding
GO:0046982 F protein heterodimerization activity
GO:0047485 F protein N-terminus binding
GO:0048013 P ephrin receptor signaling pathway
GO:0050839 F cell adhesion molecule binding
GO:0070062 C extracellular exosome
GO:0072562 C blood microparticle
GO:1903543 P positive regulation of exosomal secretion
GO:1903553 P positive regulation of extracellular exosome assembly
GO:1903561 C extracellular vesicle
RNA-seq EntryA_SariMG_comp28938_c0_seq1
Sequence
(Amino Acid)
MALYPSLEDMKVDNMMKVQMAQQSMGPSYSLPPLAGAPSAPAAHMYPALGDYMGLELSQE
VIALNMPEYRLQTVQSGGATNNLIAPISSQSPTLAKATVTQAIRQIILCKDKDGKCGVRL
HSVNSGVFVCYVGANSPAALAGLRFGDQILEINNVSVAGMTMDQCHGLLKKAPVNGITMA
VRDRPFERTITLHKDSLGHVGFHFKDGKIVGLVKDSSAARNGLLTDHQLLEINTIHVVGM
KDKEISKVIDASPTVVNITIIPSYIYQHMISKMSTSLFKELDRTPAV
*(95 a.a.)

- SilkBase 1999-2023 -