SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG10203_internal:A_SariMG_comp28924_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0004222 F metalloendopeptidase activity
GO:0005737 C cytoplasm
GO:0006338 P chromatin remodeling
GO:0006508 P proteolysis
GO:0007049 P cell cycle
GO:0007052 P mitotic spindle organization
GO:0007067 P mitotic cell cycle
GO:0007076 P mitotic chromosome condensation
GO:0007100 P mitotic centrosome separation
GO:0007155 P cell adhesion
GO:0007420 P brain development
GO:0007444 P imaginal disc development
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0008354 P germ cell migration
GO:0008406 P gonad development
GO:0016020 C membrane
GO:0016787 F hydrolase activity
GO:0019915 P lipid storage
GO:0022900 P electron transport chain
GO:0031252 C cell leading edge
GO:0045842 P positive regulation of mitotic metaphase/anaphase transition
GO:0046872 F metal ion binding
GO:0051225 P spindle assembly
GO:0051298 P centrosome duplication
GO:0051301 P cell division
GO:1902769 P regulation of choline O-acetyltransferase activity
RNA-seq EntryA_SariMG_comp28924_c1_seq1
Sequence
(Amino Acid)
IFFLFYFTEVDMNFALENYGQHSKCFDHSEKVWEQKSCRQIREWQHWGSGCYKYKCESGR
LHIVVGNYTYTCYHAGQVLQVKIIRNGWLHKGGIMCPPCKELCANEFRARKEYCKPGEEP
LPPNLYPNDVLKCGVAMVTPAVTLI
(47 a.a.)

- SilkBase 1999-2023 -