SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG1996_internal:A_SariASG_c17822_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
cytoplasmic_dynein_2_heavy_chain_1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003774 F cytoskeletal motor activity
GO:0003777 F microtubule motor activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005856 C cytoskeleton
GO:0005868 C cytoplasmic dynein complex
GO:0005874 C microtubule
GO:0005886 C plasma membrane
GO:0005929 C cilium
GO:0005930 C axoneme
GO:0007018 P microtubule-based movement
GO:0007030 P Golgi organization
GO:0007275 P multicellular organism development
GO:0007368 P determination of left/right symmetry
GO:0007507 P heart development
GO:0008105 P protein localization
GO:0009953 P dorsal/ventral pattern formation
GO:0016020 C membrane
GO:0016485 P protein processing
GO:0016887 F ATP hydrolysis activity
GO:0021522 P spinal cord motor neuron differentiation
GO:0030030 P cell projection organization
GO:0030182 P neuron differentiation
GO:0030286 C dynein complex
GO:0030326 P embryonic limb morphogenesis
GO:0030900 P forebrain development
GO:0031512 C motile cilium
GO:0035721 P intraciliary retrograde transport
GO:0042384 P cilium assembly
GO:0042995 C cell projection
GO:0045177 C apical part of cell
GO:0045880 P positive regulation of smoothened signaling pathway
GO:0060271 P cilium assembly
GO:0060976 P coronary vasculature development
GO:0070062 C extracellular exosome
RNA-seq EntryA_SariASG_c17822_g1_i1
Sequence
(Amino Acid)
WGCVCAGECAEAARGARALHAALADCARTVARAVKPTTLLHKVPVEWQLLWSGPDSLDAY
IREFAHRARAAVTRIDAWVGGATFIPNEIDLRSFLHPERVIWALRARSAAALNCSVDALE
LTVKWNCHSESDVSEGVAVRGLMLTGCECGTGTGGAGALAPAARTAPAHVPAPPLLLLTH
TGTKLILENTIEVPVYSNENREEVIFYARAPLSRTFDYET
(72 a.a.)

- SilkBase 1999-2023 -