SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG1880_complete:A_SariASG_c17041_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
dj-1_protein_[Papilio_xuthus]
Ontology
GO:0001963 P synaptic transmission, dopaminergic
GO:0003713 F transcription coactivator activity
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006508 P proteolysis
GO:0006517 P protein deglycosylation
GO:0006914 P autophagy
GO:0006954 P inflammatory response
GO:0007338 P single fertilization
GO:0008233 F peptidase activity
GO:0008344 P adult locomotory behavior
GO:0016020 C membrane
GO:0016787 F hydrolase activity
GO:0019172 F glyoxalase III activity
GO:0019243 P methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione
GO:0019249 P lactate biosynthetic process
GO:0034599 P cellular response to oxidative stress
GO:0042542 P response to hydrogen peroxide
GO:0042803 F protein homodimerization activity
GO:0043523 P regulation of neuron apoptotic process
GO:0045121 C membrane raft
GO:0050821 P protein stabilization
GO:0051583 P dopamine uptake involved in synaptic transmission
GO:0060548 P negative regulation of cell death
GO:0070301 P cellular response to hydrogen peroxide
GO:0098793 C presynapse
GO:2000277 P positive regulation of oxidative phosphorylation uncoupler activity
RNA-seq EntryA_SariASG_c17041_g1_i1
Sequence
(Amino Acid)
MFYLTVKPALFSRSISLSLRLTFKYSRCQLKEAMSKSALVILAQGAEEMETVITVDMLRR
GGVNVTLAGLDGNSPVLCSRQVTLVPDKSLTDALAENPQYDAIILPGGLEGSERLSKSQV
VGKLLKEHEKAGKIVAAICAAPTAFVAHGVAEGKRVTSYPTTKAQVAGGAGDYNYVEGER
VVVDGNIVTSRGPGTAYWFGLTLIEKLTGREKADQVEKGMLISGY
*(74 a.a.)

- SilkBase 1999-2023 -