SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG16631_5prime_partial:A_SariASG_c38902_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_LOW_QUALITY_PROTEIN:_uncharacterized_protein_LOC106719803_[Papilio_machaon]
Ontology
GO:0003677 F DNA binding
GO:0004402 F histone acetyltransferase activity
GO:0005634 C nucleus
GO:0005720 C heterochromatin
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008270 F zinc ion binding
GO:0008327 F methyl-CpG binding
GO:0009506 C plasmodesma
GO:0010216 P maintenance of DNA methylation
GO:0010223 P secondary shoot formation
GO:0016567 P protein ubiquitination
GO:0016573 P histone acetylation
GO:0016740 F transferase activity
GO:0042393 F histone binding
GO:0043966 P histone H3 acetylation
GO:0043967 P histone H4 acetylation
GO:0046872 F metal ion binding
GO:0048573 P photoperiodism, flowering
GO:0061630 F ubiquitin protein ligase activity
GO:0090308 P regulation of DNA methylation-dependent heterochromatin assembly
RNA-seq EntryA_SariASG_c38902_g1_i1
Sequence
(Amino Acid)
RAYRIGRYCPLCERSFIGPKGTMQLVICKLCDRQLHQECVRQTVSTLKVLDYTCAECRRG
GITSRAAAVRLAPRTIATLFMAKRRFNKYAHRQYLASRMANSADANDSADPPDPALDCAG
*(39 a.a.)

- SilkBase 1999-2023 -