SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1608_3prime_partial:A_SariASG_c16123_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		nucleolin,_isoform_CRA_g_[Mus_musculus]
Ontology
GO:0000166 F nucleotide binding
GO:0001525 P angiogenesis
GO:0001650 C fibrillar center
GO:0001651 C dense fibrillar component
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003697 F single-stranded DNA binding
GO:0003723 F RNA binding
GO:0005102 F signaling receptor binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005938 C cell cortex
GO:0006897 P endocytosis
GO:0007283 P spermatogenesis
GO:0008022 F protein C-terminus binding
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0030529 C ribonucleoprotein complex
GO:0032760 P positive regulation of tumor necrosis factor production
GO:0035368 F selenocysteine insertion sequence binding
GO:0036464 C cytoplasmic ribonucleoprotein granule
GO:0042134 F rRNA primary transcript binding
GO:0042162 F telomeric DNA binding
GO:0042393 F histone binding
GO:0042802 F identical protein binding
GO:0043066 P negative regulation of apoptotic process
GO:0043236 F laminin binding
GO:0043565 F sequence-specific DNA binding
GO:0044822 F RNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0070062 C extracellular exosome
GO:0071222 P cellular response to lipopolysaccharide
GO:0097421 P liver regeneration
GO:1901838 P positive regulation of transcription of nucleolar large rRNA by RNA polymerase I
GO:1990631 F ErbB-4 class receptor binding
GO:2000232 P regulation of rRNA processing
GO:2000778 P positive regulation of interleukin-6 production
RNA-seq EntryA_SariASG_c16123_g1_i1
Sequence
(Amino Acid)
MVKLAKAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEEVVIPQKKGKKATTTP
AKKVVVSQTKKAAVPTPAKKAAVTPGKKAVATPAKKNITPAKVIPTPGKKGAAQAKALVP
TPGKKGAATPAKGAKNGKNAKKEDSDEDEDEEDEEDSDEDEDDEE
(54 a.a.)

- SilkBase 1999-2023 -