SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG15969_5prime_partial:A_SariASG_c38654_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_discoidin_domain-containing_receptor_2-like_isoform_X1_[Amyelois_transitella]
Ontology
GO:0000166 F nucleotide binding
GO:0001558 P regulation of cell growth
GO:0001952 P regulation of cell-matrix adhesion
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005515 F protein binding
GO:0005518 F collagen binding
GO:0005524 F ATP binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006468 P protein phosphorylation
GO:0007155 P cell adhesion
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007565 P female pregnancy
GO:0007566 P embryo implantation
GO:0007595 P lactation
GO:0008285 P negative regulation of cell population proliferation
GO:0010715 P regulation of extracellular matrix disassembly
GO:0014909 P smooth muscle cell migration
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016323 C basolateral plasma membrane
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0030198 P extracellular matrix organization
GO:0031100 P animal organ regeneration
GO:0038062 F protein tyrosine kinase collagen receptor activity
GO:0038063 P collagen-activated tyrosine kinase receptor signaling pathway
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0043235 C receptor complex
GO:0043583 P ear development
GO:0043588 P skin development
GO:0044319 P wound healing, spreading of cells
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0060444 P branching involved in mammary gland duct morphogenesis
GO:0060749 P mammary gland alveolus development
GO:0061302 P smooth muscle cell-matrix adhesion
GO:0070062 C extracellular exosome
RNA-seq EntryA_SariASG_c38654_g1_i1
Sequence
(Amino Acid)
CSSDLFPRHRLRMISKLAEGAFGTVYVAEADGVPEYSGTITSEKRLVAVKFLCHDATIKE
RYIMDEFERDVRILAALSSPYLARVLGACRSPPLAVVLEYLDLGDLCAFLRTTAPPSTPT
LLHIATQISAGMQYLESLNFVHRDLAARNCLIGKGYQVKISDFGTDNDAYACDYYKVDGR
IPLPLRWAAWESVLCGKYTTKSDVWAFAVTLHEIFTLCRRQPYEHFTESEVLVNLSHLQE
NSGLFERLNRVSGCPRDVYELMCECWHRDELDRPTFAEMHMFLQRKSLNYTTT
*(97 a.a.)

- SilkBase 1999-2023 -