SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG15716_complete:A_SariASG_c38533_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		mothers_against_decapentaplegic_homolog_6_[Helicoverpa_armigera]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001657 P ureteric bud development
GO:0003170 P heart valve development
GO:0003281 P ventricular septum development
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006955 P immune response
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007352 P zygotic specification of dorsal/ventral axis
GO:0008285 P negative regulation of cell population proliferation
GO:0010991 P negative regulation of SMAD protein complex assembly
GO:0030509 P BMP signaling pathway
GO:0030512 P negative regulation of transforming growth factor beta receptor signaling pathway
GO:0030514 P negative regulation of BMP signaling pathway
GO:0030617 F obsolete transforming growth factor beta receptor, inhibitory cytoplasmic mediator activity
GO:0031589 P cell-substrate adhesion
GO:0031625 F ubiquitin protein ligase binding
GO:0034616 P response to laminar fluid shear stress
GO:0034713 F type I transforming growth factor beta receptor binding
GO:0035904 P aorta development
GO:0042802 F identical protein binding
GO:0043066 P negative regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0043627 P response to estrogen
GO:0044212 F transcription cis-regulatory region binding
GO:0045444 P fat cell differentiation
GO:0046872 F metal ion binding
GO:0060394 P negative regulation of pathway-restricted SMAD protein phosphorylation
GO:0060976 P coronary vasculature development
GO:0070410 F co-SMAD binding
GO:0070411 F I-SMAD binding
GO:0070412 F R-SMAD binding
GO:0070698 F type I activin receptor binding
RNA-seq EntryA_SariASG_c38533_g1_i1
Sequence
(Amino Acid)
MDDLKPKEHGESTEDARRTNHERLSAGSLATDGEERQSWESEWCRLAYWELTQRVGRQFG
VRMRAVDVFGGGGGACGSGRHGLCLDALDQRQDVPQAEQVRKTRAKIGLGVTLSLESDGV
WLYNRSQEPVFVSSPALDAAAAKALLVWRVAPGHCLCIFDPACPPPAVSLPHIGPVDPRS
VRISFAKGWGPKYSRRDVTACPCWLEVLLAPPS
*(70 a.a.)

- SilkBase 1999-2023 -