SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG15370_5prime_partial:A_SariASG_c38392_g1_i3
Scaffold_id
NCBI non-redundant
(nr)		Glyceraldehyde-3-phosphate_dehydrogenase_[Mus_musculus]
Ontology
GO:0000226 P microtubule cytoskeleton organization
GO:0004365 F glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005811 C lipid droplet
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0006006 P glucose metabolic process
GO:0006096 P glycolytic process
GO:0006417 P regulation of translation
GO:0006915 P apoptotic process
GO:0007275 P multicellular organism development
GO:0008017 F microtubule binding
GO:0015630 C microtubule cytoskeleton
GO:0016020 C membrane
GO:0016491 F oxidoreductase activity
GO:0016620 F oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0016740 F transferase activity
GO:0017148 P negative regulation of translation
GO:0019899 F enzyme binding
GO:0030529 C ribonucleoprotein complex
GO:0031965 C nuclear membrane
GO:0031982 C vesicle
GO:0035605 F peptidyl-cysteine S-nitrosylase activity
GO:0035606 P peptidyl-cysteine S-trans-nitrosylation
GO:0042802 F identical protein binding
GO:0043209 C myelin sheath
GO:0043231 C intracellular membrane-bounded organelle
GO:0050661 F NADP binding
GO:0050821 P protein stabilization
GO:0051287 F NAD binding
GO:0051402 P neuron apoptotic process
GO:0055114 P obsolete oxidation-reduction process
GO:0070062 C extracellular exosome
GO:0071346 P cellular response to interferon-gamma
GO:0097452 C GAIT complex
RNA-seq EntryA_SariASG_c38392_g1_i3
Sequence
(Amino Acid)
GRASERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMG
VNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGK
LWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAK
YDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWY
DNEYGYSNRVVDLMAYMASKE
*(86 a.a.)

- SilkBase 1999-2023 -