SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG15023_3prime_partial:A_SariASG_c38205_g1_i6
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_DDB_G0284459-like_isoform_X2_[Plutella_xylostella]
Ontology
GO:0000723 P telomere maintenance
GO:0000781 C chromosome, telomeric region
GO:0000783 C nuclear telomere cap complex
GO:0000784 C chromosome, telomeric region
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0010569 P regulation of double-strand break repair via homologous recombination
GO:0010833 P telomere maintenance via telomere lengthening
GO:0030870 C Mre11 complex
GO:0031848 P protection from non-homologous end joining at telomere
GO:0032205 P negative regulation of telomere maintenance
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0042162 F telomeric DNA binding
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048239 P negative regulation of DNA recombination at telomere
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0070187 C shelterin complex
GO:0070198 P protein localization to chromosome, telomeric region
GO:1901985 P positive regulation of protein acetylation
RNA-seq EntryA_SariASG_c38205_g1_i6
Sequence
(Amino Acid)
MTSSVVVRRGYRGGVQEYSTLEDHAIVRWLSEGNRAARVKGNAIWWDLHDQYYALTGQNR
SWQSLKNRYLRYVLPALGKLSLSPGRAAALRAAAATGLTTLYIHILVSQPIPYRSVPFLD
IPP
(40 a.a.)

- SilkBase 1999-2023 -