SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG14889_complete:A_SariASG_c38147_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		zinc_finger_protein_558_isoform_X5_[Bombyx_mori]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006349 P regulation of gene expression by genomic imprinting
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007049 P cell cycle
GO:0010628 P positive regulation of gene expression
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0042393 F histone binding
GO:0043046 P DNA methylation involved in gamete generation
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0051569 P regulation of histone H3-K4 methylation
RNA-seq EntryA_SariASG_c38147_g1_i2
Sequence
(Amino Acid)
MKDIAEGKNGFDYPYRCNDCLKGFMDGHNLEKHRKALHDPSRGDAICEICKVRYSDSRNL
NRHLRSHRLKFACRQCKHISRNTCKAVEHYKMHVGKLYKCEYCAKEYL
*(35 a.a.)

- SilkBase 1999-2023 -