SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG14812_complete:A_SariASG_c38118_g1_i3
Scaffold_id
NCBI non-redundant
(nr)		SH3_domain-containing_kinase-binding_protein_1_isoform_X2_[Bombyx_mori]
Ontology
GO:0005178 F integrin binding
GO:0005201 F extracellular matrix structural constituent
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005604 C basement membrane
GO:0005605 C basement membrane
GO:0005606 C laminin-1 complex
GO:0005607 C laminin-2 complex
GO:0005615 C extracellular space
GO:0007155 P cell adhesion
GO:0007162 P negative regulation of cell adhesion
GO:0007411 P axon guidance
GO:0007566 P embryo implantation
GO:0007611 P learning or memory
GO:0016477 P cell migration
GO:0019899 F enzyme binding
GO:0021812 P neuronal-glial interaction involved in cerebral cortex radial glia guided migration
GO:0022617 P extracellular matrix disassembly
GO:0030198 P extracellular matrix organization
GO:0030335 P positive regulation of cell migration
GO:0031012 C extracellular matrix
GO:0031175 P neuron projection development
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0042476 P odontogenesis
GO:0043208 F glycosphingolipid binding
GO:0043256 C laminin complex
GO:0043257 C laminin-8 complex
GO:0043259 C laminin-10 complex
GO:0048471 C perinuclear region of cytoplasm
GO:0070062 C extracellular exosome
RNA-seq EntryA_SariASG_c38118_g1_i3
Sequence
(Amino Acid)
MEMSKSTSSISSRMSVMESFEETKVRYSLDSKKDTTPAPREVDTSTTKPVVVHSPTAAGR
TLIVMFDEVKKPLAPSPPSASTRTNTESVTVIADRSPNSKSERIIEKQSEITTISKSASV
FEKSTTSSSNSSSSNSSGGGTLERVEKVEERLPEKLSSGSSVEKTGSSVEKMGSSVEKTG
SSTLERRLTSHKLERNTTNETDALIAQLNNRISNLEKLLEVQNTMFKSAIDELNHKLKLE
SEKRQTLQTELEKLAHCVTQV
*(86 a.a.)

- SilkBase 1999-2023 -