SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1430_5prime_partial:A_SariASG_c13300_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		innexin_inx2-like_[Helicoverpa_armigera]
Ontology
GO:0005243 F gap junction channel activity
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005921 C gap junction
GO:0006810 P transport
GO:0006811 P ion transport
GO:0007154 P cell communication
GO:0007275 P multicellular organism development
GO:0007283 P spermatogenesis
GO:0007293 P germarium-derived egg chamber formation
GO:0007440 P foregut morphogenesis
GO:0010496 P intercellular transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0016324 C apical plasma membrane
GO:0016327 C apicolateral plasma membrane
GO:0016328 C lateral plasma membrane
GO:0016331 P morphogenesis of embryonic epithelium
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030727 P germarium-derived female germ-line cyst formation
GO:0036098 P male germ-line stem cell population maintenance
GO:0042048 P olfactory behavior
GO:0048477 P oogenesis
GO:0055085 P transmembrane transport
RNA-seq EntryA_SariASG_c13300_g1_i1
Sequence
(Amino Acid)
RTYGPSGSLQVKDRLCVLPLNIVNEKIFVILWFWLLILAFVSTLAVLFRLLVLSLRPLRT
IMIMGQLKYVKRNVVSRIVKHFGFGDWYILYLLGKNVNPMIYKDLIIELSKELEHKTIMI
*(39 a.a.)

- SilkBase 1999-2023 -