SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1380_3prime_partial:A_SariASG_c12792_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		unnamed_protein_product_[Mus_musculus]
Ontology
GO:0003231 P cardiac ventricle development
GO:0003677 F DNA binding
GO:0003713 F transcription coactivator activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006810 P transport
GO:0010664 P negative regulation of striated muscle cell apoptotic process
GO:0015031 P protein transport
GO:0017025 F TBP-class protein binding
GO:0043403 P skeletal muscle tissue regeneration
GO:0048633 P positive regulation of skeletal muscle tissue growth
GO:0048742 P regulation of skeletal muscle fiber development
GO:0051451 P myoblast migration
GO:0061384 P heart trabecula morphogenesis
GO:0070062 C extracellular exosome
GO:1901227 P negative regulation of transcription from RNA polymerase II promoter involved in heart development
GO:1901228 P positive regulation of transcription from RNA polymerase II promoter involved in heart development
GO:2000138 P positive regulation of cell proliferation involved in heart morphogenesis
RNA-seq EntryA_SariASG_c12792_g1_i1
Sequence
(Amino Acid)
MPGEATETVPATEQELPQPQAETGSGTESDSDESVPELEEQDSTQTATQQAQLAAAAEID
EEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTY
IVFGEAKIEDLSQQAQLAA
(45 a.a.)

- SilkBase 1999-2023 -