SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG13709_3prime_partial:A_SariASG_c37546_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_calcium_uniporter_protein,_mitochondrial_[Amyelois_transitella]
Ontology
GO:0005262 F calcium channel activity
GO:0005515 F protein binding
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006851 P mitochondrial calcium ion transmembrane transport
GO:0015292 F uniporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019722 P calcium-mediated signaling
GO:0031305 C integral component of mitochondrial inner membrane
GO:0032024 P positive regulation of insulin secretion
GO:0034704 C calcium channel complex
GO:0035786 P protein complex oligomerization
GO:0036444 P calcium import into the mitochondrion
GO:0042593 P glucose homeostasis
GO:0042802 F identical protein binding
GO:0051560 P mitochondrial calcium ion homeostasis
GO:0051561 P positive regulation of mitochondrial calcium ion concentration
GO:0070588 P calcium ion transmembrane transport
GO:1990246 C uniplex complex
RNA-seq EntryA_SariASG_c37546_g1_i1
Sequence
(Amino Acid)
MGAQFGVLARLTWWEYSWDIMEPVTYFVTYGTAMAAYAYFVLTKQEYVLPDVKDRQHLLT
LHKKAKKIGLDINHYNTLKDEVDKLEKDLARLRDPLQIHLPSYHADKPGDDKRSPLTKIK
DMLEETGDR
(42 a.a.)

- SilkBase 1999-2023 -