SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG13643_internal:A_SariASG_c37506_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_uncharacterized_protein_LOC101737263_[Bombyx_mori]
Ontology
GO:0002674 P negative regulation of acute inflammatory response
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005923 C bicellular tight junction
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008168 F methyltransferase activity
GO:0008270 F zinc ion binding
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0030054 C cell junction
GO:0032259 P methylation
GO:0032635 P interleukin-6 production
GO:0042800 F histone methyltransferase activity (H3-K4 specific)
GO:0043124 P negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043409 P negative regulation of MAPK cascade
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0046975 F histone methyltransferase activity (H3-K36 specific)
GO:0050728 P negative regulation of inflammatory response
GO:0051568 P histone H3-K4 methylation
GO:0070062 C extracellular exosome
GO:0097676 P histone H3-K36 dimethylation
RNA-seq EntryA_SariASG_c37506_g1_i1
Sequence
(Amino Acid)
RSEERHRGEYENVAQFDADVNSLFSAVMREHGRVSTLGTVTAQLKKVYNLAKSDFAEYLT
KILGPDESLPAGFLQKTKTEEVIMCICGLHVEEGLMVQCG
(32 a.a.)

- SilkBase 1999-2023 -