SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG13410_3prime_partial:A_SariASG_c37366_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_RNA-binding_protein_38-like_[Plutella_xylostella]
Ontology
GO:0000166 F nucleotide binding
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0003730 F mRNA 3'-UTR binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006397 P mRNA processing
GO:0006977 P DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
GO:0006978 P DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
GO:0007049 P cell cycle
GO:0007050 P regulation of cell cycle
GO:0008285 P negative regulation of cell population proliferation
GO:0008380 P RNA splicing
GO:0010830 P regulation of myotube differentiation
GO:0030154 P cell differentiation
GO:0043484 P regulation of RNA splicing
GO:0044822 F RNA binding
GO:0070935 P 3'-UTR-mediated mRNA stabilization
RNA-seq EntryA_SariASG_c37366_g1_i2
Sequence
(Amino Acid)
MLMAGALPGEPEGLLALGALPGQKDTTWTKLFVGGLPYHTTDKSLREHFAVYGDIEEAVV
ITDRQTSKSRGYGFVIMGDRAAAERACKDPNPIIDGRKANVNLAILGAKPRGNLAPGFSL
AAAAAAGVRAGYPTVLPAHYGLSPGYVYGTPSYVGAMGGVGTGVSAGA
(55 a.a.)

- SilkBase 1999-2023 -