SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG13388_5prime_partial:A_SariASG_c37360_g1_i3
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_multidrug_resistance_protein_1A-like_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0002481 P antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent
GO:0002485 P antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
GO:0002489 P antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent
GO:0002591 P positive regulation of antigen processing and presentation of peptide antigen via MHC class I
GO:0005524 F ATP binding
GO:0005739 C mitochondrion
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006855 P xenobiotic transmembrane transport
GO:0008152 P metabolic process
GO:0008559 F ABC-type xenobiotic transporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0042908 P xenobiotic transport
GO:0046581 C intercellular canaliculus
GO:0055085 P transmembrane transport
RNA-seq EntryA_SariASG_c37360_g1_i3
Sequence
(Amino Acid)
GDIASKINDDLVKLEDGIGEKLATFVFYQSGFVSCVVMALVLGWKLALLCLITLPITLFL
VGLAGWVASNLAKKEAIAAGKAGNLAEEVLSSIRTVYAFSGQQKELQRYQEHLTEIRKIN
INKG
*(40 a.a.)

- SilkBase 1999-2023 -